PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa005698
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 292aa    MW: 32126 Da    PI: 7.8732
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58685629PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-18661PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.62.4e-124589147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
        Lsa005698 45 RESWTEPEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 89
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.86E-163995IPR009057Homeodomain-like
PROSITE profilePS5129413.7584094IPR017930Myb domain
TIGRFAMsTIGR015572.0E-184392IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.8E-64395IPR009057Homeodomain-like
SMARTSM007179.6E-104492IPR001005SANT/Myb domain
PfamPF002495.4E-104589IPR001005SANT/Myb domain
CDDcd001671.09E-74790No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MALPNIGSLS TPTAAVAPPS TNSSSSSVDD ASKKIRKPYT ITKSRESWTE PEHDKFLEAL  60
QLFDRDWKKI EAFIGSKTVI QIRSHAQKYF LKVQKSGTNE HLPPPRPKRK AAHPYPQKAA  120
KNPPVLSNVT SSFQSSEFLQ TNPSTLVKNT TMETGSLSHI AKDDIVSGGQ GQPIAASVNY  180
SSSNESAPKT RTTSETHEQR IHGLPSRVLP DFAQVYGFIG SVFDPNTAGH LHRLKKMDPI  240
DVETVLLLMR NLSINLTSPD FEDHRKLLSS YEVDSDKENS DDAVDALLDC GT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076101.11e-125PREDICTED: protein REVEILLE 6-like isoform X1
SwissprotQ8H0W31e-107RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A103YDJ41e-161A0A103YDJ4_CYNCS; Homeodomain-like protein
STRINGVIT_16s0050g01180.t011e-121(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-91MYB_related family protein